Protein Info for BWI76_RS13145 in Klebsiella michiganensis M5al

Annotation: phenylacetic acid degradation operon negative regulatory protein PaaX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF07848: PaaX" amino acids 22 to 90 (69 residues), 86.9 bits, see alignment E=1.3e-28 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 24 to 306 (283 residues), 364.1 bits, see alignment E=2.7e-113 PF20803: PaaX_M" amino acids 108 to 176 (69 residues), 34.2 bits, see alignment E=3.4e-12 PF08223: PaaX_C" amino acids 193 to 283 (91 residues), 92.8 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 86% identical to PAAX_ECOLI: Transcriptional repressor PaaX (paaX) from Escherichia coli (strain K12)

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 95% identity to kva:Kvar_2887)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3C3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS13145 phenylacetic acid degradation operon negative regulatory protein PaaX (Klebsiella michiganensis M5al)
MNQMSKLDTFIQQAVTAMPISGTSLIASLYGDALLQRGGEVWLGSVAALLEGLGFGERFV
RTALFRLNKEEWLDVVRIGRRSFYRLSDKGLRLTRRAEHKIYRASAPEWDGTWLLLLSEG
LEKSTLAEVKKQLLWQGFGALAPSLLASPSQKLADVQSLLHEAGVAENVICFEAHSPLAL
SRAALRARVEECWHLTDQNAMYETFITLFRPLLPLLRDCEPAELTPERSFQIQLLLIHFY
RRVVLKDPLLPEELLPAHWAGQTARQLCINIYQRVAPGALAFVGEKGESSVGELPAPGPL
YFQRFGGLAGV