Protein Info for BWI76_RS13140 in Klebsiella michiganensis M5al

Annotation: phenylacetate-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 93% identical to PAAK_ECOLI: Phenylacetate-coenzyme A ligase (paaK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_20465)

MetaCyc: 66% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30) PaaF" (EC 6.2.1.30)

MetaCyc Pathways

superpathway of phenylethylamine degradation (11/11 steps found)
phenylacetate degradation I (aerobic) (9/9 steps found)
penicillin G and penicillin V biosynthesis (3/4 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (5/9 steps found)
phenylacetate degradation II (anaerobic) (1/4 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)

KEGG Metabolic Maps

Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B370 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BWI76_RS13140 phenylacetate-CoA ligase (Klebsiella michiganensis M5al)
MTTITQLDPIESASRDELQALQTQRLKWTLKHAYDNVPMYRRKFDAAGVHPDDFHELSDL
SKFPCTTKQDLRDNYPFDTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARS
LRAAGGTAKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFKPDM
IMVTPSYCLNLIEELERQMGGDASGCSLRVGVFGAEPWTRAMRTEIERRLGISALDIYGL
SEVMGPGVAMECLETADGPTIWEDHFYPEVVNPDNGTPLTDGEHGELLFTTLTKEALPVI
RYRTRDLTRLLPGTARTMRRMDRISGRSDDMLIIRGVNVFPSQLEEEILKFEHLAPHYQL
EVNRRGHLDSLSVRVELKESGLALNHEQRCQICHQLRHRIKSMVGISTDISIVNCGSIPR
SEGKACRVFDLRKAAANG