Protein Info for BWI76_RS13130 in Klebsiella michiganensis M5al

Annotation: phenylacetic acid degradation protein PaaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 17 to 130 (114 residues), 122.2 bits, E=1.2e-39
• TIGR02286: phenylacetic acid degradation protein PaaD
  • amino acids 20 to 132 (113 residues), 165.2 bits, E=5.5e-53
• PF03061: 4HBT
  • amino acids 50 to 122 (73 residues), 72.1 bits, E=2e-24

Best Hits

Swiss-Prot: 80% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 81% identity to kpe:KPK_2992)

MetaCyc: 80% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

See A0A285B3E2 at UniProt or InterPro

Protein Sequence (140 amino acids)

>BWI76_RS13130 phenylacetic acid degradation protein PaaD (Klebsiella michiganensis M5al)
MSNEAWRNARAMYENDNCAQALGIKIIEMDDGYAQMTMAVTPNMLNGHHSCHGGQLFSLA
DTAFAYACNSQGLAAVASAASIDFLRPAFVGELLTATARVKQQGKLTGVYDIEIVNQQQK
VVALFRGKSHRIGGAITGEV