Protein Info for BWI76_RS13115 in Klebsiella michiganensis M5al

Annotation: 2,3-dehydroadipyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00378: ECH_1" amino acids 9 to 254 (246 residues), 238 bits, see alignment E=1.1e-74 PF16113: ECH_2" amino acids 14 to 179 (166 residues), 103.4 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 77% identical to PAAF_ECOLI: 2,3-dehydroadipyl-CoA hydratase (paaF) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 89% identity to kva:Kvar_2893)

MetaCyc: 56% identical to 2,3-dehydroadipyl-CoA hydratase (Pseudomonas sp. Y2)
Enoyl-CoA hydratase. [EC: 4.2.1.17]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B346 at UniProt or InterPro

Protein Sequence (255 amino acids)

>BWI76_RS13115 2,3-dehydroadipyl-CoA hydratase (Klebsiella michiganensis M5al)
MSELFIARHARVLQLTLNRPQARNALNNALLMQIADVLDAAALDPTVGVCVISGNERFFA
AGADLNEMAENDLPATLDDIRPRLWARIDAFSKPLIASVNGYALGAGCELALICDLIVAG
DNARFGLPEITLGMMPGAGGTQRLIRSVGKALASRMVLSGESIDAHQALRAGLVSEVYPP
ALTDEYALSLAATVARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFTLLSATEDRREG
IDAFLHKRTAEFKGR