Protein Info for BWI76_RS13105 in Klebsiella michiganensis M5al

Annotation: phenylacetate-CoA oxygenase subunit PaaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01883: FeS_assembly_P
  • amino acids 14 to 74 (61 residues), 31.8 bits, E=6.7e-12
• TIGR02159: phenylacetate-CoA oxygenase, PaaJ subunit
  • amino acids 22 to 165 (144 residues), 224.4 bits, E=3.3e-71

Best Hits

Swiss-Prot: 79% identical to PAAD_ECOLI: Putative 1,2-phenylacetyl-CoA epoxidase, subunit D (paaD) from Escherichia coli (strain K12)

KEGG orthology group: K02612, phenylacetic acid degradation protein (inferred from 87% identity to kva:Kvar_2895)

MetaCyc: 40% identical to anthraniloyl-[acp] 1,2-epoxidase subunit K (Streptomyces sp. S4(2010))
1.14.13.-

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaJ subunit"

MetaCyc Pathways

• antimycin biosynthesis (2/13 steps found)

Sequence Analysis Tools

See A0A285B373 at UniProt or InterPro

Protein Sequence (165 amino acids)

>BWI76_RS13105 phenylacetate-CoA oxygenase subunit PaaJ (Klebsiella michiganensis M5al)
MQRLVDIAPPEIHAVWGVLSAIPDPEVPVLTITDLGMVRSVERRGEGWVIGFTPTYSGCP
ATEHLLGEIRAVMTANGFAPVHIVLQLDPPWTTDWMGPEARERLRQYGISPPQDHACHAH
MPDEVVCPRCGSRHTSLISEFGSTACKALYRCDSCREPFDYFKCI