Protein Info for BWI76_RS13055 in Klebsiella michiganensis M5al

Annotation: NmrA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 153 to 172 (20 residues), see Phobius details PF05368: NmrA" amino acids 8 to 233 (226 residues), 162.7 bits, see alignment E=2e-51 PF01370: Epimerase" amino acids 8 to 123 (116 residues), 32 bits, see alignment E=1.8e-11 PF01073: 3Beta_HSD" amino acids 8 to 116 (109 residues), 23 bits, see alignment E=7.7e-09 PF13460: NAD_binding_10" amino acids 11 to 153 (143 residues), 68.3 bits, see alignment E=1.6e-22

Best Hits

KEGG orthology group: None (inferred from 56% identity to smk:Sinme_4749)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B366 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BWI76_RS13055 NmrA family protein (Klebsiella michiganensis M5al)
MTHTAEFLVFGATGQQGGAVARALRRAGRQVRAFVRNPHSEVARALTTEGITLAIGDLFD
LASIDRAMSGIQGVFSVQTSSPAGEISDEQEVMQGKAIADSALAAGIRHLVYSSSGAAGK
APTGMGHFDSKSTIEDYLRALPLSTTITRPASFMEMMLLPGMGLNSGHFFFFMQRHQAMQ
MIALQDLGRINAQILCNPERYRGQTLELASQALTGEDLQRAFSDAAGHPVHYHRFPDELL
AQNTFLRQLTALVDNGIVAGSADIPALEQEFGMMMTLEQWLAGPARQSFNAALNAPQANL
VLR