Protein Info for BWI76_RS13035 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 242 to 258 (17 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 427 (401 residues), 156.9 bits, see alignment E=3.4e-50

Best Hits

KEGG orthology group: None (inferred from 80% identity to ctu:CTU_23930)

Predicted SEED Role

"Putative transmembrane efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3H1 at UniProt or InterPro

Protein Sequence (484 amino acids)

>BWI76_RS13035 MFS transporter (Klebsiella michiganensis M5al)
MSSSPGLTLSSRHVSCKTPPWAGLSVLLLAGFVTIFDLFVVNVAIPSIQTGLGANFAQIG
FIVAGYELAFGVLLITGGRLGDMFGRRRLFIVGMAGFTLASAFCGLAPGTDYLICARILQ
GLAAALLFPQVYASIRVNFEDNDRRKAFGLLGMTLGLAAIAGQVLGGWLVHADLFGLSWR
IIFLINLPVGVFAILAARSIPESRAPQRPLLDWTGVLLVSCGLVLVLVPLIEGPVQGWPE
WSRWAPGLALALLVLFYRQQEQRRKAGKWPLVDMRLMANGNFSLGTMLVLLVYSTSSSFF
LCFALLVQTGIGLDAFEAGSIFAPCSVGFVLASLAAPRLVARWGTSTLFFGALIYAVFIA
IMIFQVWTSGSELKPVQLIPALIMVGAGQGYIMTPLLNLVLGFVEEAKSGMAAGVISTVQ
QIGAALGVAVVGILFNGALSKATDLSQAGQYTSAFVAGMLYNLAAAALICLLLMILKKMQ
RTEN