Protein Info for BWI76_RS12995 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 64 to 91 (28 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 67% identity to pao:Pat9b_4893)

Predicted SEED Role

"Mll5186 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B392 at UniProt or InterPro

Protein Sequence (322 amino acids)

>BWI76_RS12995 hypothetical protein (Klebsiella michiganensis M5al)
MTNIYDSTSISSQVPAAAVNSASAVSWGAIFAGAAAAASLALMLLMLGAGLGLTSISPWE
NQGLAAGTVGIAAIAWLTFTQIVASGMGGYLAGRLRTKWVDTHTNEIYFRDTAHGFLTWA
VALLVSAVLLTTTISSLIGGSAKVIGSVAGGATATAMNNAGDGASLLSKSSMEYFTHSLF
RATAATPADNSGLPANSSGNDVMAMNHPVPPKAESPAQLAEVTGIFANSINSGALPQDDL
TYVAQLVSQNTGISQKEAEQRVQAVYDKAQANLKEAKDKAQQTADAARKTTSYVTLWSFI
SLLIGAFVASLCATYGGRQRDL