Protein Info for BWI76_RS12970 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 407 to 432 (26 residues), see Phobius details amino acids 446 to 469 (24 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 422 (403 residues), 132.3 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: None (inferred from 87% identity to kpe:KPK_2229)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B359 at UniProt or InterPro

Protein Sequence (478 amino acids)

>BWI76_RS12970 MFS transporter (Klebsiella michiganensis M5al)
MSTHRITQAEPRRWAMFVILLVGAFLPPLDFFIVNVALPAIQSELGASFSAEQLVISSYA
AVYAVTLITGGRLGDIYGRGRMFFLGLIGFAAASLLCGLAWSPWVLIIGRILQGATAAIM
APQALASVQAIFPEAEKPFALSLYGAVFGLASVIGQVSGGILISANLFGLGWRTIFLVNL
PVALLVILFGVPLLKETRAQSAQRLDPVGTLLTTVMLSAVIVPLTEGREAGWPWWTWLSL
LAFPLLARLLWRYEDRLSQHGGSPLLNPAVLRAPGLGQGLAIVLLFYSIGAFFLLFSIYL
QGALHLNALTAGLIFLPFGVGFLIGPLLTPYLRRLVGNYLSAIGMGCETLGLAGLAGVIA
NTPTGSSPAALPLALLLFVTGLGQGLAMPTLVRMVTGRVAPAFSGMIAGVTSSALQLSTA
LSVAVIGGLFYSMLDNGKSAANITQAFIVALAAMSLCLAAGAGLSFRLLRRSSEWDRR