Protein Info for BWI76_RS12960 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02082: Rrf2" amino acids 5 to 134 (130 residues), 68.4 bits, see alignment E=3.7e-23

Best Hits

KEGG orthology group: None (inferred from 95% identity to eae:EAE_16635)

Predicted SEED Role

"Rrf2 family transcriptional regulator, group III" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3A1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BWI76_RS12960 transcriptional regulator (Klebsiella michiganensis M5al)
MLDYRFPTALQMVLSVAMAEQLGERSTSAILAYGLEANPSFIRKLMVPLTRDGIIVSTLG
RNGSIHLGRPAEEITLRDIYVSVIEDKKLWASRPDVPARCVVSANACWYFKSIADEAEQA
SLQVLARHTVASALEEVKKADTSGCDPVPELIAKYKEAH