Protein Info for BWI76_RS12955 in Klebsiella michiganensis M5al

Annotation: multidrug efflux RND transporter permease subunit OqxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1050 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details amino acids 472 to 499 (28 residues), see Phobius details amino acids 548 to 568 (21 residues), see Phobius details amino acids 879 to 898 (20 residues), see Phobius details amino acids 905 to 925 (21 residues), see Phobius details amino acids 931 to 955 (25 residues), see Phobius details amino acids 976 to 998 (23 residues), see Phobius details amino acids 1009 to 1033 (25 residues), see Phobius details PF00873: ACR_tran" amino acids 3 to 1034 (1032 residues), 1148.8 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 3 to 1045 (1043 residues), 1166.8 bits, see alignment E=0 PF03176: MMPL" amino acids 348 to 498 (151 residues), 38.7 bits, see alignment E=6e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to adk:Alide2_4818)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B347 at UniProt or InterPro

Protein Sequence (1050 amino acids)

>BWI76_RS12955 multidrug efflux RND transporter permease subunit OqxB (Klebsiella michiganensis M5al)
MDFSRFFIDRPIFAAVLSILIFITGLIAIPLLPVSEYPDVVPPSVQVRAEYPGANPKVIA
ETVATPLEEAINGVENMMYMKSVAGSDGVLVTTVTFRPGTDPDQAQVQVQNRVSQAEARL
PEDVRRLGITTQKQSPTLTLVVHLFSPGGKYDSLYMRNYATLKVKDELARLPGVGQIQIF
GSGEYAMRVWLDPNKVAARGLTASDVVTAMQEQNVQVSAGQLGAEPLPKESDFLISINAQ
GRLHTEEEFGNIILKTAQDGSLVRLRDVARIEMGSGSYALRSQLNNKDAVGIGIFQSPGA
NAIDLSNAVRAKMDELSKRFPQDMQWAAPYDPTVFVRDSIRAVVQTLLEAVVLVVLVVIL
FLQTWRASIIPLIAVPVSVVGTFSILYLLGFSLNTLSLFGLVLAIGIVVDDAIVVVENVE
RNIEEGLAPLAAAHQAMREVSGPIIAIALVLCAVFVPMAFLSGVTGQFYKQFAVTIAIST
VISAINSLTLSPALAALLLKPHGAPKDFPTRLIDRLFGWIFRPFNRFFHRSSNGYQGLVG
KTLGRRGAVFAVYLLLLCAAGVMFKIVPGGFIPTQDKLYLIGGVKMPEGSSLARTDAVIR
KMSEIGMNTEGVDYAVAFPGLNALQFTNTPNTGTVFFGLKPFDQRHHSAAEINAEINAKI
AQIQQGFGFSILPPPILGLGQGSGYSLYIQDRAGLGYGALQSAVNAMSGTIMQKPGMHFP
ISTYQANVPQLDVQVDRDKAKAQGVSLTDLFGTLQTYLGSSYVNDFNQFGRTWRVMAQAD
GPFRESVEDIANLRTRNNQGEMVPIGSMVNISTTYGPDPVIRYNGYPAADLIGDADPRVL
SSSQAMTQLDEMSKQILPNGMNIEWTDLSFQQATQGNTALIVFPVAVLLAFLVLAALYES
WTLPLAVILIVPMTMLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELEM
QGKGIMEAALEACRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVT
LFGLFLTPVFYVTLRKFVTRGKAVKDVSPA