Protein Info for BWI76_RS12925 in Klebsiella michiganensis M5al

Annotation: efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details PF25917: BSH_RND" amino acids 47 to 186 (140 residues), 46.9 bits, see alignment E=3e-16 PF25878: HH_AAEA_pHBA" amino acids 85 to 151 (67 residues), 33.6 bits, see alignment E=6.8e-12 PF25963: Beta-barrel_AAEA" amino acids 189 to 285 (97 residues), 109 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 43% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to kpe:KPK_B0020)

Predicted SEED Role

"possible FusE-MFP/HlyD family membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B300 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BWI76_RS12925 efflux transporter periplasmic adaptor subunit (Klebsiella michiganensis M5al)
MKSLLSLLGRYALTLIAVAVAAFVAFIFWKQYAQTPWTRDGRVRADVVQIAPDVSGPVSS
VAVRDNQWVNRGDVLYAIDPRWLKLAVLSAQADVEAKRHEMVMRQDAARRRALIKGVISS
EDIQQTGSAARVAAANYQGALAALELAQLNLSHATVRASVAGYVTHLRLRPGDYATAGET
KVAVVDAHSFWVVGYFEETKLRHIRIGSAARISLMGFDPLITGHVESIGRGIDDNNDATG
GLGLPDVNPTFSWVRLAQRVPVRIQLDKIPEGIELVAGLSASVSIVPESPDGGHSGGSGY
VDQAIHP