Protein Info for BWI76_RS12915 in Klebsiella michiganensis M5al

Annotation: 4-hydroxyphenylacetate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details TIGR02332: 4-hydroxyphenylacetate permease" amino acids 20 to 425 (406 residues), 708.6 bits, see alignment E=1.5e-217 PF07690: MFS_1" amino acids 32 to 392 (361 residues), 164.4 bits, see alignment E=1.8e-52

Best Hits

KEGG orthology group: K02511, MFS transporter, ACS family, 4-hydroxyphenylacetate permease (inferred from 66% identity to pay:PAU_00924)

Predicted SEED Role

"4-hydroxyphenylacetate symporter, major facilitator superfamily (MFS)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>BWI76_RS12915 4-hydroxyphenylacetate permease (Klebsiella michiganensis M5al)
MSTLAQSAQENHATADEQRVMSKLFRRLVAFLFVLFVFSFLDRINIGFAGLTMSQDLGLT
STMFGLAATLFYVTYVLFGVPSNIMLSRVGARRWIAVIMVVWGVASTCTLFATSAGTLYA
LRMIVGVAEAGFVPGILLYLTWWFPSWYRARANALFMIAMPLTMMFGSMLSGYILALDGV
MNLRGWQWLFLLEGLPSVILGVVTWFYLDDKPADAKWLNADEKQTLQRMMESDRSVNRKM
LTRRPVSLWREVFTPVVVLYILAYFCLTNSLSAINIWTPQILKSFNASSSNITVGLLAAI
PQFCTIVVMMWWSKRSDRLKERKRHTIYPYLFSAAGWLLTSLTAHPLIQLSGLIMASAGA
FTAMTLFWTTPDRAISVGAQAVVLATISGAGNIGSGLSPLLIGVMHDMTGNFNAGLWFMA
GLLVIGALVLVYIPMGGVQAATRIVCDKPVGRRPFWQ