Protein Info for BWI76_RS12890 in Klebsiella michiganensis M5al

Annotation: tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00104: tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA" amino acids 15 to 128 (114 residues), 94.6 bits, see alignment E=3.1e-31 PF01980: TrmO_N" amino acids 16 to 124 (109 residues), 96.2 bits, see alignment E=8.1e-32

Best Hits

KEGG orthology group: None (inferred from 44% identity to elm:ELI_1482)

Predicted SEED Role

"COG1720: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>BWI76_RS12890 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO (Klebsiella michiganensis M5al)
MKEINLYAIGGITLADDKVKIILHPPYRSGLKGIEGYSHVTLLWWCDGYDDKSSRQTVIT
STPYTEDEMGVFATRSPQRPNTIAFTTTEILHVDLNAGLLIVSWIDAENGSPVIDIKPYI
PSLDRVENPITPGYLSGWPSSLEKSADFDWSSVLNY