Protein Info for BWI76_RS12840 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 115 (100 residues), 70.8 bits, see alignment E=5.7e-24 PF00528: BPD_transp_1" amino acids 36 to 219 (184 residues), 85 bits, see alignment E=8.5e-28 PF00005: ABC_tran" amino acids 275 to 430 (156 residues), 128.1 bits, see alignment E=5.7e-41 PF13304: AAA_21" amino acids 360 to 460 (101 residues), 28.4 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to kva:Kvar_2908)

Predicted SEED Role

"FIG00731493: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B391 at UniProt or InterPro

Protein Sequence (506 amino acids)

>BWI76_RS12840 amino acid ABC transporter permease/ATP-binding protein (Klebsiella michiganensis M5al)
MTFNWNYMLSLLSDVDFWQATWTVIKLSLLTWAFSIVLGFILALAKQSPRKLFNAPARLY
IWLFRSMPLLVLLIFVYNMPQALPSFAPVLNDPFWAGLLAMVLSEAAYIAEIHRGGLLSI
PKGQSEAARALGLRYAGTQWRVVIPQALRVALPALANEYIAIVKLSSLVSVISLTEILMV
GQRLYSQNFLVMETMAAVAFYYILIVTVFDFLLKRLETWLDVTQRKTTRPVDEEMQQMAT
ARRPAMARSVSVAQEPALQASKLHKAYNNVEVLGAVSLQIQPGEVVSVIGPSGSGKTTLI
RLLNGLEQIDNGEIKINGQPFIHLNRQGQQKPRFMENSEHRQNIGMVFQSFNLFPHLTVF
GNLLLAPRYHHLASEGELKQHACELLHKVGMLEHAWKYPHQLSGGQQQRVAIARALMMRP
QIMLFDEPTSALDPEKVNEVLQVIESLAHEGITMVIVTHEMNFAFKVSDRIVFMEKGRVV
CDDTPQAMRDGQHPRVDAFLKDVSLA