Protein Info for BWI76_RS12695 in Klebsiella michiganensis M5al

Annotation: zinc transporter ZntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 268 to 290 (23 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF01544: CorA" amino acids 39 to 323 (285 residues), 234.6 bits, see alignment E=8.2e-74

Best Hits

Swiss-Prot: 93% identical to ZNTB_KLEP3: Zinc transport protein ZntB (zntB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 93% identity to kpu:KP1_2449)

MetaCyc: 85% identical to Zn2+:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-346

Predicted SEED Role

"FIG00732820: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2W1 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BWI76_RS12695 zinc transporter ZntB (Klebsiella michiganensis M5al)
MDAIKGSELNVPDAVFAWVFDGQGGVKPLVDSDTIDKEHPCWLHLNYTHVDSAEWLASTP
LLPNNVRDALAGESTRPRVTRIGDGALITLRCINGSTDERPDQLVAMRLYMDERLIVSTR
QRKVLALDDVLGDLREGNGPIDGGGWLVDVCDALTDHASEFIEQLHDRIIDLEDDLLDQQ
VPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMTDDHRRRMQDIAERLGRGLDE
IDSCIARTAIMSDEIAQIMQESLSRRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGNSWH
MGFSIFCIMLVVLIGGVTWWLHRSKWL