Protein Info for BWI76_RS12675 in Klebsiella michiganensis M5al

Annotation: putative UV protection and mutation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00817: IMS" amino acids 5 to 150 (146 residues), 129 bits, see alignment E=2.2e-41 PF11799: IMS_C" amino acids 243 to 359 (117 residues), 81.4 bits, see alignment E=9.8e-27 PF13438: DUF4113" amino acids 370 to 419 (50 residues), 67.5 bits, see alignment 1.2e-22

Best Hits

Swiss-Prot: 67% identical to UMUC_ECOLI: Protein UmuC (umuC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 68% identity to eae:EAE_20980)

MetaCyc: 67% identical to DNA polymerase V catalytic protein (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2Y0 at UniProt or InterPro

Protein Sequence (421 amino acids)

>BWI76_RS12675 putative UV protection and mutation protein (Klebsiella michiganensis M5al)
MFALVDVNSFYASCETAFRPDLRGRPVVVLSNNDGCVIARNHEAKRLEIPMGAPYFKVKS
QFERHQVAVFSSNYALYGDMSRRVMTILEELAPAVYQYSIDEAFVNLTGIHRSEELESFG
RHVRSTLLQCTGLTVGVGIGPTKTLAKLANYAAKRWPKFEGVVDLSSPVRQKKLLEKVVV
GEVWGVGRRIAKKLNEMGINTALQLAETPASLIRKHFSVVMERTVRELRGEPCLEQEEYM
PTKQQIICSRSFSQKVSEYESMREAVCSHAVRAAEKLRAEHQFCRYVSVFVKTSPFAGNE
VYYGNDAGTEIHIPTQDSRDIIAAALKCLDAIWREGYRYQKCGVMLGDFFSQGVAQLGLF
DDYRPRANSERLMTVLDSVNRREKGRLWFAGQGIERSWEMKRQMLSPAYTTRLSDLLRVK
L