Protein Info for BWI76_RS12650 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details PF07274: DUF1440" amino acids 29 to 163 (135 residues), 149.5 bits, see alignment E=3.4e-48

Best Hits

KEGG orthology group: None (inferred from 81% identity to srr:SerAS9_3305)

Predicted SEED Role

"probable integral membrane protein Cj0014c"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2V5 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BWI76_RS12650 membrane protein (Klebsiella michiganensis M5al)
MAIKDFFIQTTPARRRYGVALFVGVIAGIMSAFVKWGAEVPLPPRTFSGGRDEFNPPYLF
LRDYLGIDPTHTVYTFSEHIINPVMVTHIIFSLVFAVGYCVVAEVFPKVKLWQGAWAGIV
ATIAVHWISFPLLGLTPSLLNIPADEYISELLGHIFWFWAIEMIRRDLRNRITHEPDAEV
PLDAPFR