Protein Info for BWI76_RS12620 in Klebsiella michiganensis M5al

Annotation: 2-nitropropane dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03060: NMO
  • amino acids 5 to 324 (320 residues), 183.6 bits, E=6.7e-58

Best Hits

KEGG orthology group: K02371, enoyl-[acyl carrier protein] reductase II [EC: 1.3.1.-] (inferred from 89% identity to seh:SeHA_C1729)

Predicted SEED Role

"putative dehydrogenase"

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Fluorene degradation
• Fluorobenzoate degradation
• Isoflavonoid biosynthesis
• Phenylalanine metabolism
• Propanoate metabolism
• Tryptophan metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.-

Sequence Analysis Tools

See A0A285B396 at UniProt or InterPro

Protein Sequence (326 amino acids)

>BWI76_RS12620 2-nitropropane dioxygenase (Klebsiella michiganensis M5al)
MKNNRICQILNIEKPVIQGPLSWLTDARLVAAVSNAGGLGVLGPNAGLTAETAVSTPEET
AEKMREEIRKTKRLTEKPFGVNLIPTPENDIWTPPILQVIKEEGVRAVVYTGYGEGALIP
ALFNELKEAGIAVIYRDINPTPENTRLAEAAGADIIVATGFDEGGTLPGTALGTFSIVPL
IADAVKRIPVMAAGGITDHRTARAAHALGAEGIFAGSVFIATEESRVPASVKNRIIAANG
LDLRLFRTLPHYYRSLPGRLAEKLVSMDKAGASREALGEAMGGLRGLRIGMLEGNADEGY
ISLGTGIGNIHSVKSVAEVVDALTVD