Protein Info for BWI76_RS12600 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 314 (313 residues), 109 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: None (inferred from 80% identity to kpu:KP1_2373)

Predicted SEED Role

"Putative transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2U4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>BWI76_RS12600 MFS transporter (Klebsiella michiganensis M5al)
MTLCVFVLIASEFMPVSLLTPIARDLNVTEGLAGQGIAISGALAVLTSLTIANLAGSLNR
KYLLLGLTVLMAASGLIVALASSYAVYMAGRALIGIVIGGFWSMSAATAIRLVPQRQVPR
ALAIFNGGNALATVVAAPLGSYLGSTVGWRGAFLCLAPLAIAAFIWQCVSLPAMASDNAS
RPRGSALRLFRTPIIAIGLLACGLFFMGQFTLFTYVRPFLETVTGVSASGLSLILLAIGI
AGFIGTLGVSPLLTARFYQTLITLPLLMAAIAGTLLLAGHHAWAVAILLSLWGMLATAAP
TGWWTWIARTLPDDAEAGGGLMVAVIQLSIALGSTAGGVVFDRMGWQSAFGLSGILLLAA
VGITALTGRQARK