Protein Info for BWI76_RS12580 in Klebsiella michiganensis M5al

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 3 to 179 (177 residues), 126 bits, E=4e-40
• PF08659: KR
  • amino acids 3 to 154 (152 residues), 37.1 bits, E=9.6e-13
• PF01370: Epimerase
  • amino acids 4 to 156 (153 residues), 50 bits, E=8.1e-17
• PF13561: adh_short_C2
  • amino acids 8 to 181 (174 residues), 80.4 bits, E=5e-26
• PF13460: NAD_binding_10
  • amino acids 8 to 174 (167 residues), 38.7 bits, E=3e-13

Best Hits

KEGG orthology group: None (inferred from 86% identity to kpu:KP1_0680)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See A0A285B315 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BWI76_RS12580 oxidoreductase (Klebsiella michiganensis M5al)
MMTVLITGASSGIGAGLAKSFAADGHPVIACGRDPSRLAALQRHSPNISLRSFDMTDRES
CRQALAECRADLIILCAGTCEYLDHGTVDAALVERTIATNFLGPVNCLEALQPQLSVGNR
VVLVSSMAHWLPFPRAEAYGASKAALTWFANSLRLDWEPKGIAITVVSPGFVDTPLTRKN
DFSMPGQVSVEHAVKAIRRGLAKGKNHIVFPTGFGMLLRLLAGLPEGLQRLLLRRMVRS