Protein Info for BWI76_RS12580 in Klebsiella michiganensis M5al

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 209 to 228 (20 residues), see Phobius details PF08659: KR" amino acids 3 to 154 (152 residues), 36.5 bits, see alignment E=1.5e-12 PF00106: adh_short" amino acids 3 to 179 (177 residues), 126 bits, see alignment E=4e-40 PF01370: Epimerase" amino acids 4 to 156 (153 residues), 50 bits, see alignment E=8.1e-17 PF13460: NAD_binding_10" amino acids 8 to 130 (123 residues), 37 bits, see alignment E=9.9e-13 PF13561: adh_short_C2" amino acids 8 to 181 (174 residues), 81.7 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: None (inferred from 86% identity to kpu:KP1_0680)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B315 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BWI76_RS12580 oxidoreductase (Klebsiella michiganensis M5al)
MMTVLITGASSGIGAGLAKSFAADGHPVIACGRDPSRLAALQRHSPNISLRSFDMTDRES
CRQALAECRADLIILCAGTCEYLDHGTVDAALVERTIATNFLGPVNCLEALQPQLSVGNR
VVLVSSMAHWLPFPRAEAYGASKAALTWFANSLRLDWEPKGIAITVVSPGFVDTPLTRKN
DFSMPGQVSVEHAVKAIRRGLAKGKNHIVFPTGFGMLLRLLAGLPEGLQRLLLRRMVRS