Protein Info for BWI76_RS12565 in Klebsiella michiganensis M5al

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF02353: CMAS" amino acids 130 to 401 (272 residues), 292.1 bits, see alignment E=1.2e-90 PF13489: Methyltransf_23" amino acids 175 to 298 (124 residues), 37.6 bits, see alignment E=5.5e-13 PF08241: Methyltransf_11" amino acids 194 to 291 (98 residues), 43 bits, see alignment E=1.7e-14 PF13649: Methyltransf_25" amino acids 194 to 287 (94 residues), 49.7 bits, see alignment E=1.6e-16 PF08242: Methyltransf_12" amino acids 194 to 288 (95 residues), 35.8 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 92% identity to kva:Kvar_4548)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B331 at UniProt or InterPro

Protein Sequence (406 amino acids)

>BWI76_RS12565 SAM-dependent methyltransferase (Klebsiella michiganensis M5al)
MTDPVFALEPDIPRNVRIARWLLFRLLSGIREGSLTVREGAQTFHFGDPAAALRAEARVL
SADVYWRLLTGGSLAAAEAWMDGDWESQQLTQLLQILARNGQVLGRLERGFRLLGKPVAR
LRHWTRRNSRAQARENIAAHYDLGNDFYAHFLDDELLYSSALFTDDGQDLTQAQRAKMAR
LCDRLALTPGDRLLEIGTGWGAMAEYAARHYGCRVTTTTLSQEQFQWAKARIARAGLEDR
VEVLLCDYRDLTGQYDKLLSVEMIEAVGQRYLPAFFRTCQALLRPGGRMAIQAITIQDQR
YRDYSKSVDFIQRYIFPGGFLPSITVMNELMTRHTDFVVRDLFDMGPDYARTLAHWRQRF
THAWQDIEKLGFDDRFRRMWLYYFGYCEAGFNARTISVVQLTAERV