Protein Info for BWI76_RS12560 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 12 to 14 (3 residues), see Phobius details amino acids 16 to 43 (28 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details PF11086: DUF2878" amino acids 8 to 151 (144 residues), 87.8 bits, see alignment E=4.6e-29

Best Hits

KEGG orthology group: None (inferred from 73% identity to kpu:KP1_0675)

Predicted SEED Role

"FIG147341: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2T7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>BWI76_RS12560 hypothetical protein (Klebsiella michiganensis M5al)
MNRPASLLLTAIAFDLYWTLVVLFRERGLFIWLALAILCWLRLPPEYRASALLLAAAGCG
LDTIWALSGLVDFNGDTLLPLWMAALWLMFAVVWIRLTCAATLPGWLLALAAAFGGPTAY
LLGAYLGAMTLLAPTAAVFGAMACGWLAMMLVFHMVMGRRQ