Protein Info for BWI76_RS12490 in Klebsiella michiganensis M5al

Annotation: AbrB family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 11 to 165 (155 residues), 139.8 bits, see alignment E=3.4e-45 amino acids 190 to 344 (155 residues), 150.8 bits, see alignment E=1.3e-48 PF05145: AbrB" amino acids 34 to 344 (311 residues), 339 bits, see alignment E=1.2e-105

Best Hits

Swiss-Prot: 66% identical to ABRB_ECOLI: Putative regulator AbrB (abrB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to eae:EAE_20850)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2P2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BWI76_RS12490 AbrB family transcriptional regulator (Klebsiella michiganensis M5al)
MRIWRSDFFQWMKLLVLSSALSFVLFWFHLPAALLLGPMIAGIILSLRGAEIRVPRPFFI
AAQAIIGCMIARSLTPSIFGVLLANWALVLLILFSTLAISALAGWLLVRYSDLPGATGAW
GSSPGGASAMVIMAQEYGADVRLVALMQYLRVLFVAGAAALVVRVALGGEAQEMTQQVAW
FPPVSWQLPLTLLLTAVAGWLGLRLRFPSGAMLFPMLIGALAQGEGWLQLELPEWLLALA
YAAVGWSVGLKFNKQIFLLALKTLPQILASIIGLILLCALMAFGLTQVLPLDFMTAYLAT
SPGGLDTVAIIAAGTRADMSFIMAMQTLRLFTILLTGPAIARFISRYAARE