Protein Info for BWI76_RS12485 in Klebsiella michiganensis M5al

Annotation: TyrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 PF13188: PAS_8" amino acids 83 to 133 (51 residues), 22.7 bits, see alignment 2.4e-08 PF14532: Sigma54_activ_2" amino acids 210 to 370 (161 residues), 52.5 bits, see alignment E=2.3e-17 PF00158: Sigma54_activat" amino acids 210 to 365 (156 residues), 183 bits, see alignment E=1.4e-57 PF25601: AAA_lid_14" amino acids 374 to 440 (67 residues), 56.5 bits, see alignment E=7.3e-19 PF18024: HTH_50" amino acids 458 to 507 (50 residues), 62.8 bits, see alignment 6.6e-21 TIGR04381: TyrR family helix-turn-helix domain" amino acids 460 to 507 (48 residues), 94.1 bits, see alignment 1.9e-31

Best Hits

Swiss-Prot: 86% identical to TYRR_ECOLI: Transcriptional regulatory protein TyrR (tyrR) from Escherichia coli (strain K12)

KEGG orthology group: K03721, transcriptional regulator of aroF, aroG, tyrA and aromatic amino acid transport (inferred from 95% identity to kpu:KP1_2350)

Predicted SEED Role

"Transcriptional repressor protein TyrR" in subsystem Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Phenylalanine and Tyrosine Branches from Chorismate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2T0 at UniProt or InterPro

Protein Sequence (513 amino acids)

>BWI76_RS12485 TyrR family transcriptional regulator (Klebsiella michiganensis M5al)
MRLEVFCEDRLGLTRELLDLLVLRGIDLRGIDIDPIGRIYLNFAELEFASFSSLMAEIRR
IAGVTDVRTVAWMPSEREHLALSALLVAMPEPVLSLDTKGKVELANPASCQLFGQSQDKL
RSHPVAQLITDFNVQRWLENDPQESHAEHVVVNGQNFLLEITPVYLEGEHGEKVLTGAVA
MLRSTVRMGRQLQTMTIQDTSAFSQILAVGPKMRHVVEQARKLAMLSAPLLIVGDTGTGK
DLLAHACHLASPRAGKPYLALNCGSIPEDAVESELFGDAIQGKKGFFEQANGGSVLLDEI
GEMSPRMQTKLLRFLNDGTFRRVGEDHEVHVDVRVICATQKNLVELVQKGLFREDLYYRL
NVLTLYLPPLRDCPQDIMPLTELFVARFADEQGIPRPKLSADLNSVLTRYSWPGNVRQLK
NAIYRALTQLDGFELRPQDILLPDHDVSSLAVGEEAMEGSLDDITRRFERSVLTQLYRSF
PSTRKLAKRLGVSHTAIANKLREYGLSQKKGDE