Protein Info for BWI76_RS12470 in Klebsiella michiganensis M5al

Annotation: thiosulfate sulfurtransferase PspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02981: phage shock operon rhodanese PspE
  • amino acids 3 to 100 (98 residues), 157 bits, E=6.7e-51
• PF00581: Rhodanese
  • amino acids 21 to 96 (76 residues), 61.2 bits, E=5.7e-21

Best Hits

Swiss-Prot: 72% identical to PSPE_ECOLI: Thiosulfate sulfurtransferase PspE (pspE) from Escherichia coli (strain K12)

KEGG orthology group: K03972, phage shock protein E (inferred from 72% identity to sfl:SF1313)

MetaCyc: 72% identical to thiosulfate sulfurtransferase PspE (Escherichia coli K-12 substr. MG1655)
Thiosulfate--thiol sulfurtransferase. [EC: 2.8.1.3]; Thiosulfate sulfurtransferase. [EC: 2.8.1.3, 2.8.1.1]

Predicted SEED Role

"Phage shock protein E precursor"

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.3

Sequence Analysis Tools

See A0A285B2S3 at UniProt or InterPro

Protein Sequence (104 amino acids)

>BWI76_RS12470 thiosulfate sulfurtransferase PspE (Klebsiella michiganensis M5al)
MRKLLLGLALAMALPAFAAEHWIDVRVPQQYQKEHVVGAVNIPLADLKTRIAAEVPDKND
TIHVYCNVGRQSGQAQQLLSEMGYTQVVNAGGLSEIARPKSASK