Protein Info for BWI76_RS12435 in Klebsiella michiganensis M5al

Annotation: putative amino acid amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01891: amidohydrolase" amino acids 17 to 375 (359 residues), 336.5 bits, see alignment E=1.1e-104 PF01546: Peptidase_M20" amino acids 75 to 385 (311 residues), 142.5 bits, see alignment E=1.8e-45 PF07687: M20_dimer" amino acids 187 to 282 (96 residues), 48.3 bits, see alignment E=9e-17

Best Hits

Swiss-Prot: 37% identical to YHAA_BACSU: Putative amidohydrolase YhaA (yhaA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_20900)

MetaCyc: 44% identical to beta-tabtoxin peptidase (Pseudomonas syringae)
3.4.11.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2R9 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BWI76_RS12435 putative amino acid amidohydrolase (Klebsiella michiganensis M5al)
MTHPIIEALQVNEAQFVALRRRFHQQPEIGFEEHKTSEEVARLLGEWGYQVHRGLAGTGV
VATLSAGDGKKRLGLRADMDALPMQEMSGKAWASRVDGRFHGCGHDGHTTTLLYAAEYLA
RTRQFNGTLQLIFQPAEELLYGGRVMLEDGLFEQFPCDAIFGLHNMPGQPLGRVGLRDGA
MMASSDTLHIEVKGVGGHGAVPEHTVDATLVACHITLALQSIVSRNITPFEPAVVTVGSI
QAGHAPNIINDKVLMKLTVRTLNEQVRETVLQRIHDIAVAQAESFNASAALTHVNGSPVL
RNDPVANEMVRTVATALFGEAQVGEVKPFMGSEDFAFMLERNPNGCYFTLGAGDEADRCM
VHNPGYDFNDALLLKGAALWCALTEHYLR