Protein Info for BWI76_RS12400 in Klebsiella michiganensis M5al

Annotation: TetR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00440: TetR_N" amino acids 25 to 66 (42 residues), 44 bits, see alignment 2.3e-15 PF21993: TetR_C_13_2" amino acids 94 to 194 (101 residues), 34.6 bits, see alignment E=3e-12 PF16925: TetR_C_13" amino acids 95 to 199 (105 residues), 82.8 bits, see alignment E=3.3e-27

Best Hits

Swiss-Prot: 42% identical to ACUR_RHOS4: Transcriptional regulator AcuR (acuR) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 92% identity to eck:EC55989_4944)

Predicted SEED Role

"Transcriptional regulator, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>BWI76_RS12400 TetR family transcriptional regulator (Klebsiella michiganensis M5al)
MTGENRGRGRPRKTESTYADTRNDLIRSGLELLTQNGFLTTGVDAIVKNANVPKGSFYYY
FKSKEEYAQTVLNAYNSFFEHKLKKHLHESSCTPMVRLDNFINDACEGIKKYNFTRGCLV
GNMMQESPGLPQSFIKLLQNILESWQALVAACLSDALSLGEISSNMNETQLAAIFWSGWE
GAVMRAKLYCSTQPVCDFWSYFKASVHYLPSQEATAEQ