Protein Info for BWI76_RS12380 in Klebsiella michiganensis M5al

Annotation: DNA polymerase V subunit UmuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF00717: Peptidase_S24" amino acids 16 to 131 (116 residues), 100.2 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 74% identical to UMUD_SHIFL: Protein UmuD (umuD) from Shigella flexneri

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 96% identity to kpe:KPK_3127)

MetaCyc: 74% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone repair protein UmuD"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-

Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>BWI76_RS12380 DNA polymerase V subunit UmuD (Klebsiella michiganensis M5al)
MQFYTPVELRKIILIPLYSDLVQCGFPSPAQDYVEQRIDLNELLVNHPCATYFVKAAGDS
MKDAGIGEGDLLVVDSSRTAVHGDIVIAAVDGEFTVKKLQLHPRVQLNPMNPAYSPIVVG
SEDTLDVFGVVTYIIKSAG