Protein Info for BWI76_RS12175 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF06323: Phage_antiter_Q" amino acids 3 to 223 (221 residues), 320 bits, see alignment E=3.9e-100

Best Hits

Swiss-Prot: 69% identical to REGQ_BP82: Antitermination protein Q (Q) from Enterobacteria phage 82

KEGG orthology group: None (inferred from 75% identity to cko:CKO_01880)

Predicted SEED Role

"antiterminator-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>BWI76_RS12175 hypothetical protein (Klebsiella michiganensis M5al)
MKNLSYIRQQLIVATADLSGATKGQLMAWLENAQFDTNTFPRKKQRVWDEETEKWMTLNN
PPIPGKQSHAKGSHIPLVQPVEYATASWRRALLSLDEHQKAWLLWNYSENTRWEYQETII
RWAWEQFSQQLVGVRIAKKTVERLRQLIWLAAQDVKAELAGRETYEYQKLASLVGVTPKN
WSETFTERWEEMKRTLLRLDSDSLLQVTRSRSQQKATNLDSSLAKLD