Protein Info for BWI76_RS12010 in Klebsiella michiganensis M5al

Annotation: antimicrobial peptide ABC system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00005: ABC_tran" amino acids 31 to 178 (148 residues), 115.6 bits, see alignment E=1.4e-37

Best Hits

Swiss-Prot: 94% identical to SAPF_ECOLI: Putrescine export system ATP-binding protein SapF (sapF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_21255)

MetaCyc: 94% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B311 at UniProt or InterPro

Protein Sequence (269 amino acids)

>BWI76_RS12010 antimicrobial peptide ABC system ATP-binding protein (Klebsiella michiganensis M5al)
MVETLLEVRNLSKTFRYRTGWFHRQTVEAVKPLSFTLRERQTLAIIGENGSGKSTLAKML
AGMVEPSTGELLIDDRPLAFGDYSFRSQKIRMIFQDPSTSLNPRQRISQILDFPLRLNTD
LEPEARQKQIIETLRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIVCDEALAS
LDMSMRSQLINLMLELQEKQGISYIYVTQHLGMMKHISDQVLVMHQGEVVERGSTADVLA
SPLHDLTKRLIAGHFGEALTADAWRKDGK