Protein Info for BWI76_RS11905 in Klebsiella michiganensis M5al

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00106: adh_short" amino acids 14 to 210 (197 residues), 184.4 bits, see alignment E=3.3e-58 PF01370: Epimerase" amino acids 15 to 203 (189 residues), 22.7 bits, see alignment E=1.2e-08 PF08659: KR" amino acids 15 to 194 (180 residues), 56.1 bits, see alignment E=9.5e-19 PF13561: adh_short_C2" amino acids 19 to 241 (223 residues), 128.5 bits, see alignment E=6.5e-41

Best Hits

Swiss-Prot: 83% identical to YCIK_ECOLI: Uncharacterized oxidoreductase YciK (yciK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_21365)

MetaCyc: 51% identical to CAI-1 synthase (Vibrio cholerae O1 biovar El Tor str. N16961)
1.1.1.-

Predicted SEED Role

"YciK-like oxidoreductase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2K9 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BWI76_RS11905 NAD(P)-dependent oxidoreductase (Klebsiella michiganensis M5al)
MHYQPQRHLLQDRIILVTGASDGIGREAALTYSRYSASVILVGRNEEKLRSVAHEIQQAG
GIPARWFTLDLLTCTPQECQQLAQKIAIHYPRLDGVLHNAGLLGDVCPMDRQKPEVWQQV
MQVNVNGTFMLTQALLPLLLKSESGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLA
EEYQSRHLRVNCINPGGTRTKMRANAFPTEDPQKLKTPADIMPVYLWLMGDDSRRKTGMT
FDAQPGRKPGIAQ