Protein Info for BWI76_RS11875 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 242 to 266 (25 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 494 to 514 (21 residues), see Phobius details amino acids 554 to 573 (20 residues), see Phobius details PF09972: DUF2207" amino acids 35 to 175 (141 residues), 63 bits, see alignment E=4.5e-21

Best Hits

Swiss-Prot: 53% identical to YCIQ_ECOLI: Uncharacterized protein YciQ (yciQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 53% identity to ecj:JW5197)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2R6 at UniProt or InterPro

Protein Sequence (632 amino acids)

>BWI76_RS11875 hypothetical protein (Klebsiella michiganensis M5al)
MKWTLICRFFLLLWLFSVPFSPAHSEVLSPWQEAIALFDVQATMRQDGVLDVRENLHFQV
RNRQIKHGFFRDLPRMWVRPDGNAALLTYHVIGVTRDGKPEPWHLLWHRGTMRIVVGDEQ
TFLPEGDYRYQVHYQVSNAFIRDDEDDVLIWNVTGASWSFEIFQVRFALQLADAQGDPFR
QIDFFTGDDGERLKNGHLLPDGRIESREPFYQQDFTVLYRWPRALLPDAAEPQATHLLPH
LFIPTLSSLSVWIPCGLMAGYFLFLWLRRPRFTPVDVPVLTSMSTEFSPGYLRMAAKQTY
DDKGFCADVTNLIVKGRVALENVPGDEMLCSLVRVRSGAIHTGDIPTQEEQLLMDLLFHK
SDKVELKGRYNRTLRKAFKRMDKYYRQQHKGAGYRPLSFLLCGIVAMFATQILANAQSLG
WTARTLTADWFAGLFFVIPLLFSSVFLLSDSDPGKPIRKRLMATVLWPLIGGGLIFLFLW
AKMGFSLFQWYMPAGYFSAWCLSGYITALGFCLLPQLTQLGQQRFARAEGVIRYLGRLEA
ATHSGPRRKGESRYLDISLLSWAVAAGLGKAWANRLAPSLAAAIKAPEIARSGAFLTLQA
HLNSGSASAFGLGGSGGGFSGGGAGGGGGGGW