Protein Info for BWI76_RS11865 in Klebsiella michiganensis M5al

Annotation: phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF02811: PHP" amino acids 11 to 165 (155 residues), 43.4 bits, see alignment E=2.3e-15

Best Hits

Swiss-Prot: 81% identical to RNAAM_SALTY: 5'-3' exoribonuclease (trpH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_21410)

MetaCyc: 80% identical to RNase AM (Escherichia coli K-12 substr. MG1655)
RXN-16009 [EC: 3.1.3.97]; 3.1.13.- [EC: 3.1.3.97]; RXN-24047 [EC: 3.1.3.97]

Predicted SEED Role

"COG0613, Predicted metal-dependent phosphoesterases (PHP family)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2Y3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BWI76_RS11865 phosphatase (Klebsiella michiganensis M5al)
MSNTNYAVIYDLHSHTIASDGRLTPEELVHRAHQMRVGTLAITDHDTVAAIPAAQAEIER
AGLPLALITGVEISTLWENHEIHIVGLNIDIGHPAMIALLDEQKARRQMRGQQIAERLEK
ARIPGAWEGALKLADGGAVTRGHFARFLVEAGYANNMADVFKKYLARGKTGYVPPQWCTI
KQAIDVIHHSGGKAVIAHPGRYDLSAKWLKRLLAHFSEQGGDAMEVAQCQQAPHERAQLA
AYAVQYGLDASQGSDFHQPCPWIELGRKLWLPAGVEGIWRSWEVAVEQN