Protein Info for BWI76_RS11735 in Klebsiella michiganensis M5al

Annotation: PTS N,N'-diacetylchitobiose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 PF02255: PTS_IIA" amino acids 19 to 112 (94 residues), 108.9 bits, see alignment E=5.5e-36

Best Hits

Swiss-Prot: 84% identical to PTQA_SHIFL: PTS system N,N'-diacetylchitobiose-specific EIIA component (chbA) from Shigella flexneri

KEGG orthology group: K02759, PTS system, cellobiose-specific IIA component [EC: 2.7.1.69] (inferred from 92% identity to kpe:KPK_3209)

MetaCyc: 84% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIA component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

"PTS system, cellobiose-specific IIA component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.196 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2K3 at UniProt or InterPro

Protein Sequence (115 amino acids)

>BWI76_RS11735 PTS N,N'-diacetylchitobiose transporter subunit IIA (Klebsiella michiganensis M5al)
MFDLDNIAAEESAVNDLEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMEQSRMA
LSEAHLVQTQLIESDEGEGKMKVSLVLVHAQDHLMTSMLARELVAELIELHEKVQ