Protein Info for BWI76_RS11710 in Klebsiella michiganensis M5al

Annotation: nucleotide excision repair endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF27096: UvrC_M" amino acids 117 to 210 (94 residues), 73.2 bits, see alignment E=2e-24 PF27115: Cho_C" amino acids 223 to 286 (64 residues), 63.9 bits, see alignment E=9.4e-22

Best Hits

Swiss-Prot: 75% identical to CHO_ECO57: Excinuclease cho (cho) from Escherichia coli O157:H7

KEGG orthology group: K05984, excinuclease Cho [EC: 3.1.25.-] (inferred from 82% identity to kpe:KPK_3215)

Predicted SEED Role

"Excinuclease cho (excinuclease ABC alternative C subunit)" in subsystem DNA repair, UvrABC system

Isozymes

Compare fitness of predicted isozymes for: 3.1.25.-

Use Curated BLAST to search for 3.1.25.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2Q0 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BWI76_RS11710 nucleotide excision repair endonuclease (Klebsiella michiganensis M5al)
MARRQSAPRLEFEAAAIYAYPEHLRPWLEALPKQPGVYLFHGESDTLPLYIGKSVNIRSR
VLSHLRTPDEAAMLRQARRITWQRTAGELGALLLEAQLIKEQQPLFNKRLRQNRQLCSLR
LADDRPQVVYASELDFSQQSDLYGLFANRRAALQALQKIADEHRLCYGLMGLEPLNRGRA
CFRSALGRCAGACCGKESVETHHQRLRENMQKMQLVCWPWAGAIALEESSDDMTQYHIIQ
NWLWLGAVASLSQASSLTRLSAKFDHDGYKILCKPLLSGRYKLHPL