Protein Info for BWI76_RS11705 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 269 to 289 (21 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details amino acids 458 to 481 (24 residues), see Phobius details amino acids 493 to 517 (25 residues), see Phobius details amino acids 524 to 542 (19 residues), see Phobius details PF09972: DUF2207" amino acids 49 to 244 (196 residues), 83.4 bits, see alignment E=2.4e-27 PF20990: DUF2207_C" amino acids 306 to 606 (301 residues), 62.6 bits, see alignment E=4.7e-21

Best Hits

KEGG orthology group: None (inferred from 64% identity to kpe:KPK_0291)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2G5 at UniProt or InterPro

Protein Sequence (680 amino acids)

>BWI76_RS11705 hypothetical protein (Klebsiella michiganensis M5al)
MANLLFQGGRTLVLLLLLNISAAFAADDMIIIKDASQLPADAIPAYEHILSFDARARFNP
DGSMEMRENIKVLSLGRQIRRGIFRTLPLTWNRQDGKIFRVYYAIESVSRDGVPEPFSLD
EAEKKLTVRIGSGERVLKPGIYNYEIRYQISNHFSRFPEWDELYWNVTGNDWAWPISKAS
FHLELPDAVGNLNADAKDARLRSLDVYTGVAGAKEHNAQVLPDGSVRTLRPLARGEGLTV
VYTWPRSILADAPAPEAALPLVHLLIPTLKTGVVWLPLLLMAAYYLMWWRKNVTKAGLKM
PPVVALYSLPPGMSPGYLRFITRRKYDDVAFSSDLLALVAKRGMAVSGDSHHTHNPWLAD
SGVKQRLTRLPVEGNRRLNSDDLKLLSTLFKDKQKNIDLSKAHQRPMQNAREQLEKRCVA
QRTKVFRKWGQPLRRCIYIALLVPVVCGIWVNTQAALLTIPAAVFMLIGGAMLTCLLRFI
CRPREMWRAWGPVPLFLLAFFGPFATLGGGIFLFGILPITQLPSGYIGALMAAFALCVFV
AWKTPRYTQHGLDELAIAKGLMLYLGTAEKHRYQIIYPPEQMISHFEALLPVALALDVGK
TWANTFAHYLSSTGAMSHAFAAADWGSVEHFSEACRTASMSTPDSGSGSGSSSGSGYSGS
GSSGGGSSGGGSGGGGGGGW