Protein Info for BWI76_RS11700 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF04011: LemA" amino acids 34 to 178 (145 residues), 156.9 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 34% identical to LEMA_METJA: Protein LemA (lemA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03744, LemA protein (inferred from 84% identity to ypm:YP_2432)

Predicted SEED Role

"Putative exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2K0 at UniProt or InterPro

Protein Sequence (180 amino acids)

>BWI76_RS11700 hypothetical protein (Klebsiella michiganensis M5al)
MEMYIGLAVLVVVLIWVVMTYNRFISLRRFKDEAWSGIAVQLKRRHDLAPNLLSLVKRYA
QHEKELLEEISRQRGELVGSTRQIADNERQYSGTLGRVFALGEAYPELKASENYLALQQS
LNEIEEQLQMARRYFNGTVRDFNILVESFPSLLLARLFNFKAEAFFELDSPEEAKSPRMA