Protein Info for BWI76_RS11680 in Klebsiella michiganensis M5al

Annotation: succinylglutamate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR03240: succinylglutamate-semialdehyde dehydrogenase" amino acids 3 to 486 (484 residues), 810 bits, see alignment E=3.5e-248 PF00171: Aldedh" amino acids 13 to 458 (446 residues), 390.8 bits, see alignment E=3.7e-121

Best Hits

Swiss-Prot: 85% identical to ASTD_KLEP7: N-succinylglutamate 5-semialdehyde dehydrogenase (astD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_21590)

MetaCyc: 78% identical to aldehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Succinylglutamate-semialdehyde dehydrogenase. [EC: 1.2.1.71]

Predicted SEED Role

"Succinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71)" in subsystem Arginine and Ornithine Degradation (EC 1.2.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2P4 at UniProt or InterPro

Protein Sequence (492 amino acids)

>BWI76_RS11680 succinylglutamate-semialdehyde dehydrogenase (Klebsiella michiganensis M5al)
MSLWINGDWQSGRGPARSKHNPVSQTLLWQGNDADADQVALAVSAARAAFPAWARQPFAA
RKAIAEKFASLLEANKSELTAVIARETGKPRWEAATEITAMINKIAISVNAYHSRTGEAQ
TAMADGEATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPQSGEAV
VKLWAEAGLPPGVLNLLQGGRETGEALSGQADIDGLLFTGSSATGFQLHRQLAGQPEKIL
ALEMGGNNPLIVDDPQDIDAAVHLTIQSAFITAGQRCTCARRLLVKRGEAGDAFLQRLVT
VSQTLIPAAWDAEPQPFIGGLISAQAAQKVHQAWLAHVASGGKTLLEPRLLQAGTSLLTP
GIIEMSAVAQVADEEVFGPLLCVWRYDHFDEAIALANATRFGLSCGLISAERDKFDQLLL
EARAGIVNWNKPLTGAASTAPFGGTGASGNHRPGAWYAADYCAWPMASLESPELSLPATL
SPGLNFRQETSQ