Protein Info for BWI76_RS11660 in Klebsiella michiganensis M5al

Annotation: TVP38/TMEM64 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 35 to 63 (29 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details PF09335: SNARE_assoc" amino acids 50 to 166 (117 residues), 86.4 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 67% identical to YDJX_ECOLI: TVP38/TMEM64 family membrane protein YdjX (ydjX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 68% identity to esc:Entcl_2589)

Predicted SEED Role

"DedA family inner membrane protein YdjX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2P0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BWI76_RS11660 TVP38/TMEM64 family protein (Klebsiella michiganensis M5al)
MSIVACIIQQSGFAELVTHFDRLREAIRQSGTFGYTLYILLFIVATLFLIPGSILVIAGG
VIFGPLAGTLLSLLAATFASSLSFLFARWLGRELLIKYVGQTAIFQTIEHGIARSGSDFL
ILTRLIPLFPYNIQNYDYGLTAIPFWTFTFISALTTLPGIFIYTLLASELIRDGITSLFM
LKLTLAGLALFALIQAAKRYARYRRIATPRLLSNDEK