Protein Info for BWI76_RS11655 in Klebsiella michiganensis M5al

Annotation: TVP38/TMEM64 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 59 to 83 (25 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details PF09335: SNARE_assoc" amino acids 77 to 193 (117 residues), 88.6 bits, see alignment E=2.4e-29

Best Hits

Swiss-Prot: 76% identical to YDJZ_ECOLI: TVP38/TMEM64 family inner membrane protein YdjZ (ydjZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to eae:EAE_21615)

Predicted SEED Role

"Alkaline phosphatase like protein" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2F8 at UniProt or InterPro

Protein Sequence (232 amino acids)

>BWI76_RS11655 TVP38/TMEM64 family protein (Klebsiella michiganensis M5al)
MKNSHARSRIAIGITLLALLLAWWLIPGVHGFMQRSLAAFATLDQQAVERFIDSWGPQAA
LVSFALMILQAIIAPLPAFLITFANASLFGAFWGGALSWVSAMAGAALCFFIARALGRDA
VEKLTGKSVLQSMDGFFTRYGKHTLLICRLLPFVPFDPVSYAAGLTSMRFRHFMLATGLG
QLPATIVYSWTGSLLTGGTFWLVTGLSILFALAIVVAVAKALYLEQQKRRSR