Protein Info for BWI76_RS11585 in Klebsiella michiganensis M5al

Annotation: signal peptide peptidase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 608 (593 residues), 861.4 bits, see alignment E=3e-263 PF01343: Peptidase_S49" amino acids 140 to 297 (158 residues), 148.6 bits, see alignment E=1.5e-47 amino acids 391 to 542 (152 residues), 174.7 bits, see alignment E=1.3e-55 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 327 to 540 (214 residues), 181.1 bits, see alignment E=2.2e-57 PF00574: CLP_protease" amino acids 363 to 415 (53 residues), 20.7 bits, see alignment 3.4e-08

Best Hits

Swiss-Prot: 83% identical to SPPA_SALTI: Protease 4 (sppA) from Salmonella typhi

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 94% identity to kpn:KPN_01204)

MetaCyc: 82% identical to protease IV, a signal peptide peptidase (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2K1 at UniProt or InterPro

Protein Sequence (617 amino acids)

>BWI76_RS11585 signal peptide peptidase A (Klebsiella michiganensis M5al)
MRTLWRLLAGFFKWTWRVLNFIRQLALNVVFLVLVLACVGIWAQFSSTTTEHSTRGALLL
DITGVVVDKPSASSKLGVIGRQLFGASSDRLQENSLFDIVQTIRQAKDDRNITGIVLDLK
NFAGGDQPSMQYIGKALREFRDSGKPVYAIGSSYSQGQYYLASFANKIWLSPQGEVDLHG
FATNGLYYKSLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYLN
TIAANRQITAQQLFPGAQGVIDGLRKVDGDTAKYALDNKLVDELGTSTEVEKALTKQFGW
SKADNNYSAISYYDYSVKTPADQGSAIAVIFANGAIMDGEETPGNVGGDTTAAQIRDARL
DPKVKAIVLRVNSPGGSVSASEMIREELAAAKAAGKPVVVSMGGMAASGGYWISTPANYI
VANPSTLTGSIGIFGVINTVENTLGSIGVHTDGVATSPLADVSTTKALPPEVQQLMQLSI
ENGYKRFITLVANARKSTPEKVDQIAQGHVWTGEDAKANGLVDSLGDFDDAVAKAAELAK
LKQWHINYYQEEPTFFSMVVDSLTGSVRAALPAAVQAYLPAPVAAAANAVKTESDKLAAF
NDPQNRYAFCLTCANIR