Protein Info for BWI76_RS11500 in Klebsiella michiganensis M5al

Annotation: D-hexose-6-phosphate mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF01263: Aldose_epim" amino acids 28 to 268 (241 residues), 151.4 bits, see alignment E=1.9e-48

Best Hits

Swiss-Prot: 84% identical to YEAD_SALTY: Putative glucose-6-phosphate 1-epimerase (yeaD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01792, glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (inferred from 87% identity to kpe:KPK_3248)

Predicted SEED Role

"Aldose 1-epimerase family protein YeaD"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2K8 at UniProt or InterPro

Protein Sequence (294 amino acids)

>BWI76_RS11500 D-hexose-6-phosphate mutarotase (Klebsiella michiganensis M5al)
MINKIFALPVIEQLTPVLSRRQLDDLELIVVDHPQVKASVALQGAHLLSWKPAGEEEVLW
LSGNTPFKNGVALRGGVPICWPWFGPSAQPGLPSHGFARNLPWALKGHDEDDKGAVLTFE
LKSSEATRQYWPHEFTLLARFKLGKTCEIELEAHGEFETTSALHTYFNVGDIAAVKVSGL
GERYIDKVKNAEEGVLSNGTETFPDRTDRVYLNAETCSVIHDDALNRNIDVTHHHNSNVV
AWNPGPALSVSMGDMPDDGYKTFVCVETCCVTETQKASEEKPSRLAQTLRVVKR