Protein Info for BWI76_RS11495 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 17 to 272 (256 residues), 184.2 bits, E=1.5e-58

Best Hits

Swiss-Prot: 70% identical to YEAE_ECOLI: Uncharacterized protein YeaE (yeaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to kva:Kvar_3119)

MetaCyc: 70% identical to methylglyoxal reductase YeaE (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]

Predicted SEED Role

"Putative oxidoreductase YeaE, aldo/keto reductase family"

MetaCyc Pathways

• methylglyoxal degradation III (2/2 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)
• D-arabinose degradation V (1/3 steps found)
• detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
• superpathway of pentose and pentitol degradation (21/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycerolipid metabolism
• Pentose and glucuronate interconversions
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

See A0A285B2D1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BWI76_RS11495 hypothetical protein (Klebsiella michiganensis M5al)
MAERTIRFGEHPAVPVIGQGTWYMGENPALRAQEAAALRAGIDLGLTVIDTAEMYADGGA
EEVVGEAIRGQRDRVVLVSKVYPWNAGGRKIARACEASLRRLNTDYLDLYLLHWRGDYSL
QETVAGMEALVAQGKIRRWGVSNLDEDDMQQLWQVEGGERCATNQVLYHLASRGIEYDLL
PWCQQRRLPVMAYCPLAQAGRLRNGLLNHTVVKNIAQERGVTAAQILLAWVISHREVLAI
PKASSIEHVAQNAAALDIVLNDEELALLDKAYPAPARKTPLDMV