Protein Info for BWI76_RS11460 in Klebsiella michiganensis M5al

Annotation: DUF441 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 145 (34 residues), see Phobius details PF04284: DUF441" amino acids 7 to 145 (139 residues), 155.1 bits, see alignment E=5.8e-50

Best Hits

Swiss-Prot: 95% identical to Y1150_KLEP7: UPF0756 membrane protein KPN78578_11500 (KPN78578_11500) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_21755)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2D5 at UniProt or InterPro

Protein Sequence (148 amino acids)

>BWI76_RS11460 DUF441 family protein (Klebsiella michiganensis M5al)
MLDTTLLILLGLAALGFISHNTTVAISILVLIIVRVTPLNAFFPWIEKQGLTIGIIILTI
GVMAPIASGTLPPSTLLHSFVNWKSLLAIAVGVFVSWLGGRGVALMGSQPQLVAGLLVGT
VLGVALFRGVPVGPLIAAGIISLFIGKS