Protein Info for BWI76_RS11425 in Klebsiella michiganensis M5al

Annotation: GAF domain/diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF13185: GAF_2" amino acids 17 to 154 (138 residues), 42.9 bits, see alignment E=9.1e-15 PF01590: GAF" amino acids 19 to 151 (133 residues), 30.6 bits, see alignment E=7e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 170 to 331 (162 residues), 137.6 bits, see alignment E=1.7e-44 PF00990: GGDEF" amino acids 175 to 329 (155 residues), 139.5 bits, see alignment E=1.3e-44

Best Hits

Swiss-Prot: 56% identical to DGCP_ECOLI: Diguanylate cyclase DgcP (dgcP) from Escherichia coli (strain K12)

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 77% identity to kva:Kvar_3186)

MetaCyc: 56% identical to diguanylate cyclase DgcP (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00731529: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2E5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BWI76_RS11425 GAF domain/diguanylate cyclase (Klebsiella michiganensis M5al)
MSDFILARVTQTLANEHSLETLVRQLLEMLELVTRMESTYLTRIDFDAQRQLIMYAHNSS
EMQIPEGFSVPWNDSLCKRALDERCLFSNDVAERWRSCIAAQDLGITTFFSIPVRLTDGS
LFGTLCATSRVRQPYNLEGEQVMNLFANLIAHYVEKETLVQQLRSANVALEMHSYTDELT
GLPNRRSLFKYLAAQFPRAREQRRSMLLIFIDLDDFKAINDRFGHPCGDNFLIQVGERLA
AHVRSGDIVGRLGGDEFLIVGPGPELADQQEYIAALRQALTGIYFLGEHRINYPGASFGV
IEADPQQIDVEQALRAADDAMYLDKQSRRQGRFFHID