Protein Info for BWI76_RS11405 in Klebsiella michiganensis M5al

Annotation: lipid A biosynthesis acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 124 to 138 (15 residues), see Phobius details TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 4 to 304 (301 residues), 442.9 bits, see alignment E=3.1e-137 PF03279: Lip_A_acyltrans" amino acids 5 to 295 (291 residues), 342.8 bits, see alignment E=8.3e-107

Best Hits

Swiss-Prot: 73% identical to LPXP_SHIFL: Lipid A biosynthesis palmitoleoyltransferase (lpxP) from Shigella flexneri

KEGG orthology group: K12974, palmitoleoyl transferase [EC: 2.3.1.-] (inferred from 90% identity to kpu:KP1_2185)

MetaCyc: 73% identical to palmitoleoyl acyltransferase (Escherichia coli K-12 substr. MG1655)
PALMITOTRANS-RXN [EC: 2.3.1.242]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2I8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BWI76_RS11405 lipid A biosynthesis acyltransferase (Klebsiella michiganensis M5al)
MSYAFNKKLLHPRNWGTWFGLGVLWLIVQLPYPVLHLIGTSAGRASRRFLKRREHIARRN
LELCFPTMSPAAREKLIEQNFMSLGMGLIETGMAWFWSDERVKKWFDVEGMVNLNNALSE
QKGVMVVGVHFMSLELGGRTMGLCRPMMATYRPHNSPLMEWVQTRGRLRSNKAMIDRRNL
SGLVHALKSGEAVWFAPDQDYGPKGSVFAPFFSVQQAATTNGTYVLSRLSGAKMLTISMV
RKADRRGYSLHISDVMSDYPGEDKQDAASYINKVIEKEILRAPEQYLWVHRRFKTRPLGE
TSLY