Protein Info for BWI76_RS11380 in Klebsiella michiganensis M5al

Annotation: iron-dicitrate transporter substrate-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 40 to 268 (229 residues), 87.1 bits, see alignment E=6.5e-29

Best Hits

Swiss-Prot: 70% identical to FECB_ECOLI: Fe(3+) dicitrate-binding periplasmic protein (fecB) from Escherichia coli (strain K12)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 74% identity to cko:CKO_03834)

MetaCyc: 70% identical to ferric citrate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system, periplasmic iron-binding protein FecB (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2G3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BWI76_RS11380 iron-dicitrate transporter substrate-binding subunit (Klebsiella michiganensis M5al)
MFSLVRLCIFSLLFLAGPVFAVTVQDEHGRFTLDKTPQRIVVLELSFVDALAAVNVSPIG
VADDNDPSRILSDVRACLKPWQSVGTRAQPSLEAISALHPDLIVADSSRHAGIYAALRQI
APVLLLKSRNETWEENLQSAAIIGKVVGQDEEMQRRLAQHRQKMAAFSRQLPAGASVLFG
TSREQQFNLHSSQTYTGSVLAALGLKVPLPNGGAPMAAINLEQLLALNPQWLLVAHYRAE
SIVTKWQQDALWPILQAEQKQQVAAVDSDSWARMRGIVAAERIASDMVKIVHHQAVDIAP