Protein Info for BWI76_RS11370 in Klebsiella michiganensis M5al

Annotation: iron-dicitrate transporter subunit FecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 226 to 254 (29 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF01032: FecCD" amino acids 12 to 315 (304 residues), 308.1 bits, see alignment E=3.1e-96

Best Hits

Swiss-Prot: 67% identical to FECD_ECOLI: Fe(3+) dicitrate transport system permease protein FecD (fecD) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 70% identity to pct:PC1_0972)

MetaCyc: 67% identical to ferric citrate ABC transporter membrane subunit FecD (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2I9 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS11370 iron-dicitrate transporter subunit FecD (Klebsiella michiganensis M5al)
MRRRIVFLLLALTLLTLFSLRMGAIPLPWQVLLSGWHADSEYHYVLMQYRLPRVVLALII
GAALAVSGALVQGVVHNPLASPDILGINHGASLASVAALWFLPSLPLPWLPLLAFIGGMS
AMTIAIALAGFSHPMRLALTGIALSACWASVTDYLLLSRPQEINNALLWLTGSLWARDGS
FVVIALPLLAILLPLSFALSRDLDLLALGRDRAGTLGVNVRRLNGYALTLAVALASIGVA
VCGPIAFISLVVPHLVRRLFGGRHRYLLPLSALTGGLVLLLADLLARTLHPPLELPAGVL
TAIIGAPWFIWLLVRMR