Protein Info for BWI76_RS11350 in Klebsiella michiganensis M5al

Annotation: DeoR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 186 to 205 (20 residues), see Phobius details PF00672: HAMP" amino acids 205 to 254 (50 residues), 28.7 bits, see alignment 2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 426 to 586 (161 residues), 162.1 bits, see alignment E=4.8e-52 PF00990: GGDEF" amino acids 427 to 584 (158 residues), 146.8 bits, see alignment E=7.6e-47

Best Hits

KEGG orthology group: None (inferred from 80% identity to kva:Kvar_3194)

Predicted SEED Role

"FIG00731414: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B296 at UniProt or InterPro

Protein Sequence (594 amino acids)

>BWI76_RS11350 DeoR family transcriptional regulator (Klebsiella michiganensis M5al)
MRIATMTNWAYGITVALTLASGIAMLMASSADNAERRAVEQRQVFDQLSEEVESGAWELS
DLARLYIIKKNQDVLQEYRQQTQAITAIERRLVKLKDNGATAEELALLREGLQMADELQD
EQRTALAQVARGEEKEAVNLLYGTAYEQELERVQTQLDHFRLMLEGRVNKTIAEATEKSR
IWRTLSEVMVGLTALMFLFVLGFILKRRVLYPVVRLSDVVQRLASQDYAVETPQFTQIDE
IGDMAQAIRIFRENGLARQRLEQERDADWAVRELLARMTQRLQGCESFEDVIKVAELFAP
NIAPAIPGRLYILDTDPWQMRCVAQWLSPPLEADVFHPDNCWAVRRGLSHPPVNGEPDIA
CYHLSESQANQSLCVPLIAQGEAIGLLSFSNVTSATAPSRAYLELMAEALGLALANQRLR
NALLEKALFDSLTGLRNRHHLDDALHTQMNLAVRNGTPLSCLMIDIDHFKAINDSYGHEA
GDLVIKSVAAIIQRAVRDIGMAFRYGGEEFLVLLGGTDEQSAMVCANDIYNSVHLLTLRY
GLAEIGQIDVSIGIASYPQHTQSDSLLRAADAALYRAKELGRSRIVSFGMLKAD